Novus Biologicals
Manufacturer Code:NBP15537020UL
Catalog # NBP15537020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RNASE9(ribonuclease RNase A family 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: h461 HEL128 ribonuclear enzyme ribonuclease 9 ribonuclease RNase A family 9 (non-active) ribonuclease-like protein 9; Inactive ribonuclease-like protein 9; ribonuclear enzyme; ribonuclease A K1; ribonuclease, RNase A family, 9 (non-active)
Gene Aliases: h461; HEL128; RAK1; RNASE9
UniProt ID: (Human) P60153
Entrez Gene ID: (Human) 390443
Molecular Function:
RNA binding protein
endoribonuclease
enzyme modulator
hydrolase
nuclease
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.