Novus Biologicals
Manufacturer Code:NBP191220
Catalog # NBP191220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Capping protein regulator and myosin 1 linker 2; Capping protein, Arp2/3 and myosin-I linker protein 2; CARMIL2 CARMIL2b leucine rich repeat containing 16C leucine-rich repeat-containing protein 16C LRRC16C RGD motif leucine rich repeats tropomodulin domain and proline-rich containing RGD leucine-rich repeat tropomodulin and proline-rich containing protein RGD leucine-rich repeat tropomodulin and proline-rich-containing protein; F-actin-uncapping protein RLTPR; leucine rich repeat containing 16C; Leucine-rich repeat-containing protein 16C; RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing; RGD, leucine-rich repeat, tropomodulin and proline-rich containing protein; RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein
Gene Aliases: CARMIL2; CARMIL2b; LRRC16C; RLTPR
UniProt ID: (Human) Q6F5E8
Entrez Gene ID: (Human) 146206
Molecular Function: nucleic acid binding transcription cofactor transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.