Novus Biologicals
Manufacturer Code:NBP230825
Catalog # NBP230825
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ammonium transporter Rh type C; ammonium transporter Rh type C CDRC2 chromosome 15 open reading frame 6 PDRC2C15orf6 Rh family type C glycoprotein Rh family C glycoprotein Rh glycoprotein kidney Rh type C glycoprotein Rhesus blood group family type C glycoprotein Rhesus blood group C glycoprotein RHGKTumor-related protein DRC2 SLC42A3; Rh family type C glycoprotein; Rh family, C glycoprotein; Rh glycoprotein kidney; Rh type C glycoprotein; Rhesus blood group family type C glycoprotein; Rhesus blood group, C glycoprotein; Tumor-related protein DRC2
Gene Aliases: C15orf6; CDRC2; PDRC2; RHCG; RHGK; SLC42A3
UniProt ID: (Human) Q9UBD6
Entrez Gene ID: (Human) 51458
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.