Novus Biologicals
Manufacturer Code:NBP169483
Catalog # NBP169483
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RHBG(Rh family B glycoprotein) The peptide sequence was selected from the C terminal of RHBG. Peptide sequence LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ammonium transporter Rh type B; ammonium transporter Rh type B Rh family type B glycoprotein Rh family B glycoprotein (gene/pseudogene) Rh type B glycoprotein Rhesus blood group family type B glycoprotein Rhesus blood group B glycoprotein SLC42A2; Rh family type B glycoprotein; Rh family, B glycoprotein; Rhesus blood group family type B glycoprotein; Rhesus blood group, B glycoprotein
Gene Aliases: RHBG; SLC42A2
UniProt ID: (Human) Q9H310
Entrez Gene ID: (Human) 57127
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.