Novus Biologicals
Manufacturer Code:NBP183654
Catalog # NBP183654
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1 EC 2.1.1.- EC 2.1.1.36 FLJ20432 HBV pre-S2 trans-regulated protein 2 Mitochondrial RNase P protein 1 MRPP1mitochondrial ribonuclease P protein 1 NY-REN-49 antigen Renal carcinoma antigen NY-REN-49 RNA (guanine-9-) methyltransferase domain containing 1 RNA (guanine-9-)-methyltransferase domain-containing protein 1; HBV pre-S2 trans-regulated protein 2; Mitochondrial ribonuclease P protein 1; Mitochondrial RNase P protein 1; mitochondrial RNase P subunit 1; mRNA methyladenosine-N(1)-methyltransferase; Renal carcinoma antigen NY-REN-49; RNA (guanine-9-) methyltransferase domain containing 1; RNA (guanine-9-)-methyltransferase domain-containing protein 1; tRNA (adenine(9)-N(1))-methyltransferase; tRNA (guanine(9)-N(1))-methyltransferase; tRNA methyltransferase 10 homolog C
Gene Aliases: COXPD30; HNYA; MRPP1; RG9MTD1; TRMT10C
UniProt ID: (Human) Q7L0Y3
Entrez Gene ID: (Human) 54931
Molecular Function:
DNA binding protein
DNA methyltransferase
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.