Novus Biologicals
Manufacturer Code:NBP189059
Catalog # NBP189059
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 60 kDa origin-specific DNA-binding protein; 60 kDa origin-specific DNA-binding protein 60 kDa replication initiation region protein ATT-binding protein DHFR oribeta-binding protein RIP60 H_DJ0584D14.12 replication initiation region protein (60kD) replication initiator 1 RIP60AP4 Zfp464 Zinc finger protein 464 zinc finger protein 464 (RIP60) zinc finger protein AP4 zinc finger proten AP4 ZNF464; 60 kDa replication initiation region protein; ATT-binding protein; DHFR oribeta-binding protein RIP60; H_DJ0584D14.12; replication initiation region protein (60kD); Replication initiator 1; Zinc finger protein 464; zinc finger protein 464 (RIP60); zinc finger protein AP4
Gene Aliases: AP4; REPIN1; RIP60; Zfp464; ZNF464
UniProt ID: (Human) Q9BWE0
Entrez Gene ID: (Human) 29803
Molecular Function: KRAB box transcription factor transcription factor zinc finger transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.