Novus Biologicals
Manufacturer Code:NBP162374
Catalog # NBP162374
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the middle region of REEP1. Peptide sequence AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C2orf23 chromosome 2 open reading frame 23 receptor accessory protein 1 receptor expression-enhancing protein 1 SPG31FLJ13110; Receptor expression-enhancing protein 1; Spastic paraplegia 31 protein
Gene Aliases: C2orf23; HMN5B; REEP1; SPG31; Yip2a
UniProt ID: (Human) Q9H902
Entrez Gene ID: (Human) 65055
Molecular Function:
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.