Novus Biologicals
Manufacturer Code:NBP187117
Catalog # NBP187117
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1 EC 1.1.1 EC 1.1.1.105 Microsomal NAD+-dependent retinol dehydrogenase 4 retinol dehydrogenase 16 retinol dehydrogenase 16 (all-trans and 13-cis) retinol dehydrogenase 16 (all-trans) RoDH-4 RODH4 SDR9C8 short chain dehydrogenase/reductase family 9C member 8 Sterol/retinol dehydrogenase; hRDH-E; Human epidermal retinol dehydrogenase; Microsomal NAD(+)-dependent retinol dehydrogenase 4; microsomal NAD+-dependent retinol dehydrogenase 4; Retinol dehydrogenase 16; retinol dehydrogenase 16 (all-trans and 13-cis); RoDH-4; Short chain dehydrogenase/reductase family 9C member 8; short chain dehydrogenase/reductase family 9C, member 8; Sterol/retinol dehydrogenase
Gene Aliases: RDH16; RODH-4; RODH4; SDR9C8
UniProt ID: (Human) O75452
Entrez Gene ID: (Human) 8608
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.