Novus Biologicals
Manufacturer Code:NBP231647
Catalog # NBP231647
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alcohol dehydrogenase PAN2; Alcohol dehydrogenase PAN2 EC 1.1.1.- PAN2retinol dehydrogenase 14 pancreas protein 2 retinol dehydrogenase 14 (all-trans and 9-cis) retinol dehydrogenase 14 (all-trans/9-cis/11-cis) SDR7C4 short chain dehydrogenase/reductase family 7C member 4; pancreas protein 2; Retinol dehydrogenase 14; retinol dehydrogenase 14 (all-trans and 9-cis); Short chain dehydrogenase/reductase family 7C member 4; short chain dehydrogenase/reductase family 7C, member 4
Gene Aliases: PAN2; RDH14; SDR7C4; UNQ529/PRO1072
UniProt ID: (Human) Q9HBH5
Entrez Gene ID: (Human) 57665
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.