Novus Biologicals
Manufacturer Code:NBP192324
Catalog # NBP192324
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp313H0740 EC 1.1.1.- FLJ39479 retinol dehydrogenase 13 retinol dehydrogenase 13 (all-trans and 9-cis) retinol dehydrogenase 13 (all-trans/9-cis) SDR7C3 short chain dehydrogenase/reductase family 7C member 3; Retinol dehydrogenase 13; retinol dehydrogenase 13 (all-trans and 9-cis); Short chain dehydrogenase/reductase family 7C member 3; short chain dehydrogenase/reductase family 7C, member 3
Gene Aliases: PSEC0082; RDH13; SDR7C3; UNQ736/PRO1430
UniProt ID: (Human) Q8NBN7
Entrez Gene ID: (Human) 112724
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.