Novus Biologicals
Manufacturer Code:NBP185638
Catalog # NBP185638
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cell cycle regulatory protein; Cell cycle regulatory protein CHC1RCC1-I chromosome condensation 1 Chromosome condensation protein 1 guanine nucleotide-releasing protein regulator of chromosome condensation regulator of chromosome condensation 1 SNHG3-RCC1 SNHG3-RCC1 readthrough transcript; Chromosome condensation protein 1; guanine nucleotide-releasing protein; Regulator of chromosome condensation; SNHG3-RCC1 readthrough
Gene Aliases: CHC1; RCC1; RCC1-I; SNHG3-RCC1
UniProt ID: (Human) P18754
Entrez Gene ID: (Human) 1104
Molecular Function:
DNA binding protein
G-protein modulator
chromatin/chromatin-binding protein
enzyme modulator
guanyl-nucleotide exchange factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.