Novus Biologicals
Manufacturer Code:NBP157483
Catalog # NBP157483
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human RBPMS (NP_001008710). Peptide sequence RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ32971 Heart and RRM expressed sequence Hermes HERMESRNA-binding protein with multiple splicing RBP-MS RNA binding protein with multiple splicing; Heart and RRM expressed sequence; Hermes; RBP-MS; RNA-binding protein with multiple splicing
Gene Aliases: HERMES; RBPMS
UniProt ID: (Human) Q93062
Entrez Gene ID: (Human) 11030
Molecular Function:
RNA binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.