Novus Biologicals
Manufacturer Code:NBP184383
Catalog # NBP184383
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cellular retinoic acid-binding protein 4; Cellular retinoic acid-binding protein 4 Cellular retinoic acid-binding protein IV CRABP4 CRABP-IV CRBP4 CRBPIV MGC70641 putative cellular retinol-binding protein CRBP IV retinoid binding protein 7 retinoid-binding protein 7 retinol binding protein 7 cellular; Cellular retinoic acid-binding protein IV; cellular retinol binding protein 7; CRABP-IV; CRABP4; putative cellular retinol-binding protein CRBP IV; retinoid binding protein 7; Retinoid-binding protein 7; retinol binding protein 7, cellular
Gene Aliases: CRBP4; CRBPIV; RBP7
UniProt ID: (Human) Q96R05
Entrez Gene ID: (Human) 116362
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.