Novus Biologicals
Manufacturer Code:NBP174143
Catalog # NBP174143
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CMAVM DKFZp434N071 GAPp120GAPCM-AVM GTPase-activating protein p120RASGAP PKWS ras GTPase-activating protein 1 Ras p21 protein activator RAS p21 protein activator (GTPase activating protein) 1 RASA RasGAP triphosphatase-activating protein; GAP; p120 RAS GTPase activating protein; p120GAP; Ras GTPase-activating protein 1; Ras p21 protein activator; RAS p21 protein activator (GTPase activating protein) 1; triphosphatase-activating protein
Gene Aliases: CM-AVM; CMAVM; GAP; p120; p120GAP; p120RASGAP; PKWS; RASA; RASA1; RASGAP
UniProt ID: (Human) P20936
Entrez Gene ID: (Human) 5921
Molecular Function: G-protein modulator enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.