Novus Biologicals
Manufacturer Code:NBP157044
Catalog # NBP157044
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the N terminal of RAPGEF3. Peptide sequence RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 9330170P05Rik; 9330170P05Rik bcm910 cAMP-GEFI cAMP-regulated guanine nucleotide exchange factor I CGEF1 EPAC 1 EPAC1 EPACRAP guanine-nucleotide-exchange factor (GEF) 3 Exchange factor directly activated by cAMP 1 Exchange protein directly activated by cAMP 1 HSU79275 MGC21410 Rap guanine nucleotide exchange factor (GEF) 3 rap guanine nucleotide exchange factor 3 Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; cAMP-GEFI; cAMP-regulated guanine nucleotide exchange factor I; EPAC 1; Exchange factor directly activated by cAMP 1; Exchange protein directly activated by cAMP 1; Rap guanine nucleotide exchange factor (GEF) 3; Rap guanine nucleotide exchange factor 3; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP
Gene Aliases: bcm910; CAMP-GEFI; CGEF1; EPAC; EPAC1; HSU79275; RAPGEF3
UniProt ID: (Human) O95398
Entrez Gene ID: (Human) 10411
Molecular Function:
G-protein modulator
enzyme modulator
guanyl-nucleotide exchange factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.