Novus Biologicals
Manufacturer Code:NBP15487120UL
Catalog # NBP1548720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAP1B(RAP1B member of RAS oncogene family) The peptide sequence was selected from the N terminal of RAP1B. Peptide sequence MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp586H0723 GTP-binding protein smg p21B K-REV RAL1B RAP1B member of RAS oncogene family Ras family small GTP binding protein RAP1B ras-related protein Rap-1b RAS-related protein RAP1B small GTP binding protein; GTP-binding protein smg p21B; Ras family small GTP binding protein RAP1B; Ras-related protein Rap-1b; RAS-related protein RAP1B; small GTP binding protein
Gene Aliases: K-REV; OK/SW-cl.11; RAL1B; RAP1B
UniProt ID: (Human) P61224
Entrez Gene ID: (Human) 5908
Molecular Function:
G-protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.