Novus Biologicals
Manufacturer Code:NBP158314
Catalog # NBP158314
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: KIAA0351RalGEF 2 Ral GEF with PH domain and SH3 binding motif 1 Ral GEF with PH domain and SH3-binding motif 1 Ral guanine nucleotide exchange factor 2 Ral guanine nucleotide exchange factor RalGPS1A RalA exchange factor RalGPS1 RALGEF2RALGPS1A ras-specific guanine nucleotide-releasing factor RalGPS1; Ral GEF with PH domain and SH3-binding motif 1; Ral guanine nucleotide exchange factor 2; Ral guanine nucleotide exchange factor RalGPS1A; RalA exchange factor RalGPS1; RalGEF 2; Ras-specific guanine nucleotide-releasing factor RalGPS1
Gene Aliases: KIAA0351; RALGEF2; RALGPS1; RALGPS1A
UniProt ID: (Human) Q5JS13
Entrez Gene ID: (Human) 9649
Molecular Function: G-protein modulator enzyme modulator guanyl-nucleotide exchange factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.