Novus Biologicals
Manufacturer Code:NBP174190
Catalog # NBP174190
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ChIP assay (ChIP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E3 ubiquitin-protein ligase RAG1; Endonuclease RAG1; MGC43321 RAG-1 recombination activating gene 1 RING finger protein 74 RNF74recombination activating protein 1 V(D)J recombination-activating protein 1; RAG-1; recombination activating protein 1; RING finger protein 74; RING-type E3 ubiquitin transferase RAG1; V(D)J recombination-activating protein 1
Gene Aliases: RAG-1; RAG1; RNF74
UniProt ID: (Human) P15918
Entrez Gene ID: (Human) 5896
Molecular Function:
DNA binding protein
endodeoxyribonuclease
hydrolase
nuclease
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.