Novus Biologicals
Manufacturer Code:NBP15718720UL
Catalog # NBP15718720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAE1 (RAE1 RNA export 1 homolog (S. pombe)) The peptide sequence was selected from the C terminal of RAE1. Peptide sequence SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ481F12.3 dJ800J21.1 FLJ30608 homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer) MGC117333 MGC126076 MGC126077 MIG14 migration-inducing gene 14 Mnrp41 mRNA export factor mRNA export protein mRNA-associated protein mrnp 41 mRNA-binding protein 41-kD MRNP41 RAE1 (RNA export 1 S.pombe) homolog Rae1 protein homolog RAE1 RNA export 1 homolog (S. pombe); homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); migration-inducing gene 14; mRNA export factor; mRNA export protein; mRNA-associated protein MRNP 41; mRNA-binding protein, 41-kD; Rae1 protein homolog; RAE1 RNA export 1 homolog
Gene Aliases: dJ481F12.3; dJ800J21.1; MIG14; Mnrp41; MRNP41; RAE1
UniProt ID: (Human) P78406
Entrez Gene ID: (Human) 8480
Molecular Function:
RNA binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.