Novus Biologicals
Manufacturer Code:NBP198473
Catalog # NBP198473
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Rac2 - C-terminal region. Peptide sequence LALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPCSLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GX; Gx HSPC022 ras-related C3 botulinum toxin substrate 2 (rho family small GTP bindingprotein Rac2) rho family small GTP binding protein Rac2 small GTP-bindingprotein Rac2); p21-Rac2; Ras-related C3 botulinum toxin substrate 2; Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2); Small G protein
Gene Aliases: EN-7; Gx; HSPC022; p21-Rac2; RAC2
UniProt ID: (Human) P15153
Entrez Gene ID: (Human) 5880
Molecular Function: G-protein enzyme modulator small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.