Novus Biologicals
Manufacturer Code:NBP155183
Catalog # NBP155183
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.5.1.60 Geranylgeranyl transferase type II subunit alpha geranylgeranyl transferase type-2 subunit alpha protein prenyltransferase alpha subunit repeat containing 3 PTAR3 Rab geranylgeranyltransferase subunit alpha Rab geranyl-geranyltransferase subunit alpha Rab geranylgeranyltransferase alpha subunit Rab GG transferase alpha Rab GGTase alpha; Geranylgeranyl transferase type II subunit alpha; Geranylgeranyl transferase type-2 subunit alpha; protein prenyltransferase alpha subunit repeat containing 3; Rab geranyl-geranyltransferase subunit alpha; Rab geranylgeranyltransferase subunit alpha; Rab geranylgeranyltransferase, alpha subunit; Rab GG transferase alpha; Rab GGTase alpha
Gene Aliases: PTAR3; RABGGTA
UniProt ID: (Human) Q92696
Entrez Gene ID: (Human) 5875
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.