Novus Biologicals
Manufacturer Code:NBP16909520UL
Catalog # NBP16909520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAB8B (RAB8B member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ38125 RAB-8b protein RAB8B member RAS oncogene family ras-related protein Rab-8B; RAB-8b protein; Ras-related protein Rab-8B
Gene Aliases: RAB8B
UniProt ID: (Human) Q92930
Entrez Gene ID: (Human) 51762
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.