Novus Biologicals
Manufacturer Code:NBP179960
Catalog # NBP179960
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human RAB8AThe immunogen for this antibody is RAB8A. Peptide sequence GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14) mel transforming oncogene (derived from cell line NK14)- RAB8 homolog MELras-associated protein RAB8 Oncogene c-mel RAB8A member RAS oncogene family RAB8mel transforming oncogene (RAB8 homolog) ras-related protein Rab-8A; mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; mel transforming oncogene (RAB8 homolog); Oncogene c-mel; ras-associated protein RAB8; Ras-related protein Rab-8A
Gene Aliases: MEL; RAB8; RAB8A
UniProt ID: (Human) P61006
Entrez Gene ID: (Human) 4218
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.