Novus Biologicals
Manufacturer Code:NBP184198
Catalog # NBP184198
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZP434D245 FLJ14579 KIAA0839p150 RAB3 GTPase activating protein subunit 2 (non-catalytic) Rab3 GTPase-activating protein 150 kDa subunit rab3 GTPase-activating protein non-catalytic subunit Rab3-GAP p150 Rab3-GAP regulatory subunit Rab3-GAP150 RAB3GAP150 RGAP-iso; RAB3 GTPase activating protein subunit 2 (non-catalytic); Rab3 GTPase-activating protein 150 kDa subunit; Rab3 GTPase-activating protein non-catalytic subunit; Rab3-GAP p150; Rab3-GAP regulatory subunit; Rab3-GAP150; RGAP-iso
Gene Aliases: KIAA0839; p150; RAB3-GAP150; RAB3GAP150; RAB3GAP2; SPG69; WARBM2
UniProt ID: (Human) Q9H2M9
Entrez Gene ID: (Human) 25782
Molecular Function: G-protein modulator enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.