Novus Biologicals
Manufacturer Code:NBP157000
Catalog # NBP157000
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAB39 (RAB39 member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39. Peptide sequence METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Rab-39; rab-39 RAB39 member RAS oncogene family RAB39A rab-related GTP-binding protein ras-related protein Rab-39A; rab-related GTP-binding protein; RAB39, member RAS oncogene family; Ras-related protein Rab-39A
Gene Aliases: RAB39; RAB39A
UniProt ID: (Human) Q14964
Entrez Gene ID: (Human) 54734
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.