Novus Biologicals
Manufacturer Code:NBP15688920UL
Catalog # NBP15688920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAB22A(RAB22A member RAS oncogene family) The peptide sequence was selected from the middle region of RAB22A. Peptide sequence IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GTP-binding protein RAB22A; GTP-binding protein RAB22A MGC16770 Rab-22 RAB22 RAB22A member RAS oncogene family ras-related protein Rab-22A; Rab-22; Ras-related protein Rab-22A
Gene Aliases: RAB22; RAB22A
UniProt ID: (Human) Q9UL26
Entrez Gene ID: (Human) 57403
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.