Novus Biologicals
Manufacturer Code:NBP158863
Catalog # NBP158863
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAB18(RAB18 member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB18. Peptide sequence LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: RAB18 small GTPase; RAB18 small GTPase RAB18 member RAS oncogene family RAB18LI1 ras-related protein Rab-18; Ras-related protein Rab-18
Gene Aliases: RAB18; RAB18LI1; WARBM3
UniProt ID: (Human) Q9NP72
Entrez Gene ID: (Human) 22931
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.