Novus Biologicals
Manufacturer Code:NBP179582
Catalog # NBP179582
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp434H018 Gaf-1 GAF1rab11-FIP5 Gamma-SNAP-associated factor 1 KIAA0857gaf-1 Phosphoprotein pp75 pp75 RAB11 family interacting protein 5 (class I) Rab11-FIP5 Rab11-interacting protein Rip11 RAB11RIP5 RIP11rab11 family-interacting protein 5; Gaf-1; Gamma-SNAP-associated factor 1; Phosphoprotein pp75; RAB11 family interacting protein 5 (class I); Rab11 family-interacting protein 5; Rab11-FIP5; Rab11-interacting protein Rip11
Gene Aliases: GAF1; KIAA0857; pp75; RAB11FIP5; RIP11
UniProt ID: (Human) Q9BXF6
Entrez Gene ID: (Human) 26056
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.