Novus Biologicals
Manufacturer Code:NBP184000
Catalog # NBP184000
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARFO1 Arfophilin-1 EF hands-containing Rab-interacting protein Eferin FIP3-Rab11 KIAA0665arfophilin-1 MU-MB-17.148 PAC196A12.1 RAB11 family interacting protein 3 (class II) rab11-family interacting protein 3 Rab11-FIP3rab11 family-interacting protein 3; Arfophilin-1; cytoplasmic adaptor for RAR and TR; EF hands-containing Rab-interacting protein; Eferin; FIP3-Rab11; MU-MB-17.148; PAC196A12.1; RAB11 family interacting protein 3 (class II); Rab11 family-interacting protein 3; rab11-family interacting protein 3
Gene Aliases: ARFO1; CART1; KIAA0665; Rab11-FIP3; RAB11FIP3
UniProt ID: (Human) O75154
Entrez Gene ID: (Human) 9727
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.