Novus Biologicals
Manufacturer Code:NBP15294820UL
Catalog # NBP15294820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to QTRTD1(queuine tRNA-ribosyltransferase domain containing 1) The peptide sequence was selected from the N terminal of QTRTD1. Peptide sequence YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.29 FLJ12960 queuine tRNA-ribosyltransferase domain containing 1 Queuine tRNA-ribosyltransferase domain-containing protein 1 queuine tRNA-ribosyltransferase subunit QTRTD1; Queuine tRNA-ribosyltransferase accessory subunit 2; queuine tRNA-ribosyltransferase domain containing 1; Queuine tRNA-ribosyltransferase domain-containing protein 1
Gene Aliases: QTRT2; QTRTD1
UniProt ID: (Human) Q9H974
Entrez Gene ID: (Human) 79691
Molecular Function:
G-protein modulator
chaperone
enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.