Novus Biologicals
Manufacturer Code:NBP15305620UL
Catalog # NBP15305620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.29 Guanine insertion enzyme queuine tRNA-ribosyltransferase queuine tRNA-ribosyltransferase 1 TGTFP3235 TGUT tRNA-guanine transglycosylase; Guanine insertion enzyme; queuine tRNA-ribosyltransferase 1; Queuine tRNA-ribosyltransferase catalytic subunit 1; TGT, 43-KD subunit; TGT, catalytic subunit; tRNA-guanine transglycosylase
Gene Aliases: FP3235; QTRT1; TGT; TGUT
UniProt ID: (Human) Q9BXR0
Entrez Gene ID: (Human) 81890
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.