Novus Biologicals
Manufacturer Code:NBP255409
Catalog # NBP255409
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.8.3.2 FLJ34858 hQSOX Q6 QSCN6 Quiescin Q6 quiescin Q6 sulfhydryl oxidase 1 sulfhydryl oxidase 1; hQSOX; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62n; thiol oxidase 1
Gene Aliases: Q6; QSCN6; QSOX1; UNQ2520/PRO6013
UniProt ID: (Human) O00391
Entrez Gene ID: (Human) 5768
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.