Novus Biologicals
Manufacturer Code:NBP156621
Catalog # NBP156621
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to QRSL1(glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1) The peptide sequence was selected from the N terminal of QRSL1. Peptide sequence SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp564C1278 EC 6.3.5 EC 6.3.5.- FLJ10989 FLJ12189 FLJ13447 GatA glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 Glutaminyl-tRNA synthase-like protein 1 glutamyl-tRNA(Gln) amidotransferase subunit A homolog; Glu-AdT subunit A; Glutaminyl-tRNA synthase-like protein 1; glutamyl-tRNA(Gln) amidotransferase subunit A homolog; Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial; glutamyl-tRNA(Gln) amidotransferase, subunit A; QRSL1
Gene Aliases: GatA; QRSL1
UniProt ID: (Human) Q9H0R6
Entrez Gene ID: (Human) 55278
Molecular Function:
hydrolase
ligase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.