Novus Biologicals
Manufacturer Code:NBP179632
Catalog # NBP179632
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human QARSThe immunogen for this antibody is QARS. Peptide sequence DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1 EC 6.1.1.18 GLNRS glutamine tRNA ligase Glutamine--tRNA ligase glutamine-tRNA synthetase glutaminyl-tRNA synthetase PRO2195; GlnRS; Glutamine--tRNA ligase; glutamine-tRNA synthetase; Glutaminyl-tRNA synthetase
Gene Aliases: GLNRS; MSCCA; PRO2195; QARS; QARS1
UniProt ID: (Human) P47897
Entrez Gene ID: (Human) 5859
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.