Novus Biologicals
Manufacturer Code:NBP182432
Catalog # NBP182432
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNNEFGT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1 mitochondrial EC 3.1.3 EC 3.1.3.43 MGC119646 PDH PDP 1 PDPC PDPC 1 PDPFLJ32517 PPM2CFLJ56179 Protein phosphatase 2C protein phosphatase 2C magnesium-dependent catalytic subunit pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase Pyruvate dehydrogenase phosphatase catalytic subunit 1 pyruvate dehyrogenase phosphatase catalytic subunit 1; [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial; PDP 1; PDPC 1; Protein phosphatase 2C; protein phosphatase 2C, magnesium-dependent, catalytic subunit; protein phosphatase, Mg2+/Mn2+ dependent 2A; pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase; Pyruvate dehydrogenase phosphatase catalytic subunit 1
Gene Aliases: PDH; PDP; PDP1; PDPC; PPM2A; PPM2C
UniProt ID: (Human) Q9P0J1
Entrez Gene ID: (Human) 54704
Molecular Function:
enzyme modulator
hydrolase
kinase inhibitor
kinase modulator
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.