Novus Biologicals
Manufacturer Code:NBP185955
Catalog # NBP185955
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; EC 2.7.11 EC 2.7.11.2 mitochondrial pyruvate dehydrogenase lipoamide kinase isoenzyme 1 PDH kinase 1 PDK1 PDK-1 PKB kinase Pyruvate dehydrogenase kinase isoform 1 pyruvate dehydrogenase kinase isoenzyme 1 pyruvate dehydrogenase kinase isozyme 1 Pyruvate dehydrogenase lipoamide kinase isozyme 1 mitochondrial; mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1; PDH kinase 1; Pyruvate dehydrogenase kinase isoform 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1
Gene Aliases: PDHK1; PDK1
UniProt ID: (Human) Q15118
Entrez Gene ID: (Human) 5163
Molecular Function: kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.