Novus Biologicals
Manufacturer Code:NBP188282
Catalog # NBP188282
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C21orf124 C21orf97 chromosome 21 open reading frame 124 DKFZp566A071 EC 2.7.1.35 FLJ21324 FLJ37311 MGC15873 MGC31754 MGC52346 PKHchromosome 21 open reading frame 97 PNKhuman pyridoxal kinase EC 2.7.1.3510FLJ31940 PRED79 pyridoxal (pyridoxine vitamin B6) kinase pyridoxal kinase pyridoxamine kinase Pyridoxine kinase vitamin B6 kinase; epididymis secretory sperm binding protein Li 1a; Pyridoxal kinase; pyridoxamine kinase; Pyridoxine kinase; vitamin B6 kinase
Gene Aliases: C21orf124; C21orf97; HEL-S-1a; PDXK; PKH; PNK; PRED79
UniProt ID: (Human) O00764
Entrez Gene ID: (Human) 8566
Molecular Function:
kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.