Novus Biologicals
Manufacturer Code:NBP154353
Catalog # NBP154353
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NP(nucleoside phosphorylase) The peptide sequence was selected from the middle region of NP. Peptide sequence GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.1 FLJ94043 FLJ97288 Inosine phosphorylase MGC117396 MGC125915 MGC125916 NPFLJ97312 nucleoside phosphorylase PRO1837 PUNP purine nucleoside phosphorylase purine-nucleoside:orthophosphate ribosyltransferase; epididymis secretory sperm binding protein Li 156an; HEL-S-156an; Inosine phosphorylase; Inosine-guanosine phosphorylase; PNP; Purine nucleoside phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase
Gene Aliases: NP; PNP; PRO1837; PUNP
UniProt ID: (Human) P00491
Entrez Gene ID: (Human) 4860
Molecular Function: phosphorylase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.