Novus Biologicals
Manufacturer Code:NBP160065
Catalog # NBP160065
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PCDH15(protocadherin 15) The peptide sequence was selected from the N terminal of PCDH15. Peptide sequence HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: autosomal recessive 23 cadherin-related family member 15 DKFZp667A1711 protocadherin-15 protocadherin-related 15; cadherin-related family member 15; Protocadherin-15; protocadherin-related 15
Gene Aliases: CDHR15; DFNB23; PCDH15; USH1F
UniProt ID: (Human) Q96QU1
Entrez Gene ID: (Human) 65217
Molecular Function:
cadherin
cell adhesion molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.