Novus Biologicals
Manufacturer Code:NBP190311
Catalog # NBP190311
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 9630046K23Rik; 9630046K23Rik C3orf9 CAP10-like protein 46 kDa chromosome 3 open reading frame 9 CLP46 EC 2.4.1.- hCLP46CAP10-like 46 kDa protein KDELC family like 1 KDELCL1 KTEL (Lys-Tyr-Glu-Leu) containing 1 KTEL motif-containing protein 1 MDS010 MDSRPKTELC1 MGC32995 Myelodysplastic syndromes relative protein protein O-glucosyltransferase 1 Rumi x 010 protein; CAP10-like 46 kDa protein; hCLP46; hRumi; KDELC family like 1; KTEL (Lys-Tyr-Glu-Leu) containing 1; KTEL motif-containing protein 1; Myelodysplastic syndromes relative protein; O-glucosyltransferase Rumi homolog; Protein O-glucosyltransferase 1; protein O-xylosyltransferase; Protein O-xylosyltransferase POGLUT1; x 010 protein
Gene Aliases: C3orf9; CLP46; hCLP46; KDELCL1; KTELC1; MDS010; MDSRP; POGLUT1; Rumi; UNQ490/PRO1006
UniProt ID: (Human) Q8NBL1
Entrez Gene ID: (Human) 56983
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.