Novus Biologicals
Manufacturer Code:NBP154592
Catalog # NBP154592
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PSMB4(proteasome (prosome macropain) subunit beta type 4) The peptide sequence was selected from the middle region of PSMB4 (NP_002787). Peptide sequence YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 26 kDa prosomal protein; EC 3.4.25.1 HN3 hsBPROS26 HsN3 Macropain beta chain Multicatalytic endopeptidase complex beta chain PROS26PROS-26 proteasome (prosome macropain) subunit beta type 4 Proteasome beta chain Proteasome chain 3 proteasome subunit beta type-4 proteasome subunit HsN3 proteasome subunit beta type 426 kDa prosomal protein; HsBPROS26; HsN3; Macropain beta chain; Multicatalytic endopeptidase complex beta chain; proteasome (prosome, macropain) subunit, beta type, 4; Proteasome beta chain; Proteasome chain 3; Proteasome subunit beta type-4; proteasome subunit HsN3; proteasome subunit, beta type, 4; testis tissue sperm-binding protein Li 79P
Gene Aliases: HN3; HsN3; PROS-26; PROS26; PSMB4
UniProt ID: (Human) P28070
Entrez Gene ID: (Human) 5692
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.