Novus Biologicals
Manufacturer Code:NBP187852
Catalog # NBP187852
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.3.99.3 MGC10317 MGST1L1MGST1-like 1 MGST1-L1mPGES-1 MGST-IV Microsomal glutathione S-transferase 1-like 1 Microsomal prostaglandin E synthase 1 MPGES MPGES1 MPGES-1 p53-induced apoptosis protein 12 p53-induced gene 12 protein PGESmicrosomal prostaglandin E synthase-1 PIG12glutathione S-transferase 1-like 1 PP102 PP1294 prostaglandin E synthase TP53I12 tumor protein p53 inducible protein 12; Glutathione peroxidase PTGES; glutathione S-transferase 1-like 1; Glutathione transferase PTGES; MGST1-L1; MGST1-like 1; Microsomal glutathione S-transferase 1-like 1; Microsomal prostaglandin E synthase 1; microsomal prostaglandin E synthase-1; MPGES-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; Prostaglandin E synthase; tumor protein p53 inducible protein 12
Gene Aliases: MGST-IV; MGST1-L1; MGST1L1; MPGES; mPGES-1; MPGES1; PGES; PIG12; PP102; PP1294; PTGES; TP53I12
UniProt ID: (Human) O14684
Entrez Gene ID: (Human) 9536
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.