Novus Biologicals
Manufacturer Code:NBP169146
Catalog # NBP169146
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.4.21 EC 3.4.21.94 KEX2-like endoprotease 2 NEC 2 NEC2SPC2 neuroendocrine convertase 2 PC2NEC-2 Prohormone convertase 2 Proprotein convertase 2 proprotein convertase subtilisin/kexin type 2; KEX2-like endoprotease 2; NEC 2; Neuroendocrine convertase 2; PC2; Prohormone convertase 2; Proprotein convertase 2
Gene Aliases: NEC 2; NEC-2; NEC2; PC2; PCSK2; SPC2
UniProt ID: (Human) P16519
Entrez Gene ID: (Human) 5126
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.