Novus Biologicals
Manufacturer Code:NBP198312
Catalog # NBP198312
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is prohibitin 2 - middle region. Peptide sequence REYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B-cell associated protein; B-cell receptor-associated protein BAP37; BAP Bap37 BCAP37 B-cell associated protein D-prohibitin MGC117268 p22 PNAS-141 prohibitin 2 prohibitin-2 REAB-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity; D-prohibitin; PHB2; Prohibitin-2; Repressor of estrogen receptor activity
Gene Aliases: BAP; Bap37; BCAP37; hBAP; p22; PHB2; PNAS-141; REA
UniProt ID: (Human) Q99623
Entrez Gene ID: (Human) 11331
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.