Novus Biologicals
Manufacturer Code:NBP15932620UL
Catalog # NBP15932620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PENK(proenkephalin) The peptide sequence was selected from the middle region of PENK. Peptide sequence DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: enkephalin A; enkephalin A preproenkephalin proenkephalin proenkephalin-A; Leu-enkephalin; Met-enkephalin; Met-enkephalin-Arg-Gly-Leu; Met-enkephalin-Arg-Phe; OGF; Opioid growth factor; PENK(114-133); PENK(143-183); PENK(237-258); preproenkephalin; Proenkephalin-A; Synenkephalin
Gene Aliases: PE; PENK; PENK-A
UniProt ID: (Human) P01210
Entrez Gene ID: (Human) 5179
Molecular Function: neuropeptide peptide hormone signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.