Novus Biologicals
Manufacturer Code:NBP192287
Catalog # NBP192287
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: caspase-2 binding protein; caspase-2 binding protein FLJ32987 HSPC190 marginal zone B and B1 cell-specific protein MGC29506 PACAP pERp1 plasma cell-induced ER protein 1 plasma cell-induced resident endoplasmic reticulum protein Plasma cell-induced resident ER protein Proapoptotic caspase adapter protein proapoptotic caspase adaptor protein; HSPC190; marginal zone B and B1 cell-specific protein; Marginal zone B- and B1-cell-specific protein; MEDA-7; Mesenteric estrogen-dependent adipose 7; mesenteric oestrogen-dependent adipose gene- 7; plasma cell-induced ER protein 1; Plasma cell-induced resident endoplasmic reticulum protein; Plasma cell-induced resident ER protein; Proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein
Gene Aliases: HSPC190; MEDA-7; MEDA7; MZB1; PACAP; pERp1
UniProt ID: (Human) Q8WU39
Entrez Gene ID: (Human) 51237
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.