Novus Biologicals
Manufacturer Code:NBP238508
Catalog # NBP238508
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alternative prion protein; AltPrP; ASCR; CD230; CD230 antigen; CD230 CJD fatal familial insomnia) GSS prion protein prion protein (p27-30) prion protein PrP prion-related protein PRIPMGC26679; Major prion protein; prion-related protein; PrP; PrP27-30; PrP33-35C
Gene Aliases: ALTPRP; ASCR; CD230; CJD; GSS; KURU; p27-30; PRIP; PRNP; PRP; PrP27-30; PrP33-35C; PrPc
UniProt ID: (Human) O60489
Entrez Gene ID: (Human) 5621
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.