Novus Biologicals
Manufacturer Code:NBP157947
Catalog # NBP157947
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PLXNA4(plexin A4) The peptide sequence was selected from the middle region of PLXNA4. Peptide sequence TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A DKFZp434G0625 FAYV2820 FLJ35026 FLJ38287 KIAA1550DKFZp566O0546 plexin A4 plexin A4 B plexin-A4 PLXNA4A PLXNA4B PRO34003; Plexin-A4
Gene Aliases: FAYV2820; KIAA1550; PLEXA4; PLXNA4; PLXNA4A; PLXNA4B; PRO34003; UNQ2820/PRO34003
UniProt ID: (Human) Q9HCM2
Entrez Gene ID: (Human) 91584
Molecular Function:
kinase
protein kinase
protein kinase receptor
receptor
signaling molecule
transferase
tyrosine protein kinase receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.