Novus Biologicals
Manufacturer Code:NBP158978
Catalog # NBP158978
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KLKB1(kallikrein B plasma (Fletcher factor) 1) The peptide sequence was selected from the middle region of KLKB1. Peptide sequence VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.4.21 EC 3.4.21.34 Fletcher factor kallikrein B plasma (Fletcher factor) 1 kininogenin KLK3plasma kallikrein plasma kallikrein heavy chain plasma kallikrein light chain Plasma prekallikrein PPK; Fletcher factor; kallikrein B, plasma (Fletcher factor) 1; Kininogenin; PKK; Plasma kallikrein; Plasma kallikrein heavy chain; Plasma kallikrein light chain; Plasma prekallikrein
Gene Aliases: KLK3; KLKB1; PKK; PKKD; PPK
UniProt ID: (Human) P03952
Entrez Gene ID: (Human) 3818
Molecular Function:
annexin
calcium-binding protein
calmodulin
enzyme modulator
hydrolase
intracellular calcium-sensing protein
peptide hormone
protease
protease inhibitor
receptor
serine protease
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.