Novus Biologicals
Manufacturer Code:NBP192273
Catalog # NBP192273
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CPHD1 GHF1 GHF-1pituitary-specific positive transcription factor 1 Growth hormone factor 1 PIT-1 PIT1pituitary-specific transcription factor 1 POU class 1 homeobox 1 POU domain class 1 transcription factor 1 POU domain class 1 transcription factor 1 POU1F1a; GHF-1; Growth hormone factor 1; PIT-1; Pituitary-specific positive transcription factor 1; POU domain, class 1, transcription factor 1
Gene Aliases: CPHD1; GHF-1; GHF1; Pit-1; PIT1; POU1F1; POU1F1a
UniProt ID: (Human) P28069
Entrez Gene ID: (Human) 5449
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.